PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC07G08180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 384aa    MW: 41470.6 Da    PI: 7.0243
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC07G08180.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.5e-17104150148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEde l + v+ +G + W+ Ia++++ gR +kqc++rw ++l
  OPUNC07G08180.1 104 KGGWTREEDEVLREMVRHHGDRKWAEIAKRLP-GRIGKQCRERWTNHL 150
                      688*****************************.************996 PP

2Myb_DNA-binding56.66.1e-18158198345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eEd +l++a++ +G++ W++Iar ++ gR+++ +k++w+
  OPUNC07G08180.1 158 IWTEEEDRKLIKAHQTYGNR-WSAIARSLP-GRSENTVKNHWN 198
                      6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.48799154IPR017930Myb domain
SuperFamilySSF466893.88E-30102197IPR009057Homeodomain-like
SMARTSM007172.1E-16103152IPR001005SANT/Myb domain
PfamPF002496.3E-16104150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-23106153IPR009057Homeodomain-like
CDDcd001672.19E-16107150No hitNo description
Gene3DG3DSA:1.10.10.601.5E-21154202IPR009057Homeodomain-like
SMARTSM007178.7E-17155203IPR001005SANT/Myb domain
PROSITE profilePS5129417.447155205IPR017930Myb domain
PfamPF002495.0E-16159198IPR001005SANT/Myb domain
CDDcd001679.51E-15159201No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MGDSFLNQEL VMATDRMPNS HFMTSSNGGA CYQNTGAPIT IGVCNLGCLV ASIGMVPSSS  60
LMPERGLATA SFNSVSDFPT GAAMMDQEQH MQAAGSNNNS GLVKGGWTRE EDEVLREMVR  120
HHGDRKWAEI AKRLPGRIGK QCRERWTNHL HPDIRKDIWT EEEDRKLIKA HQTYGNRWSA  180
IARSLPGRSE NTVKNHWNAT KRSLNSKRRL RKKNSEQAVP GQPSLLEDYI RSCQHPLPSE  240
TAPSSSALPT SFDIGGYGPG ETIDVSPTPP AAHALGGSTP PGLVMFLDLL NQAIPHSPQP  300
EDLNNLNITP VAPTHHTSGY CLQLDARGNL LPMQPHGISA QAGPSSIGAG GSIGGMDCNG  360
VVASSQFVMP SEDGGILDMV RWIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-421022065110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.10.0PREDICTED: transcription factor RAX1-like
TrEMBLA0A0E0LIW60.0A0A0E0LIW6_ORYPU; Uncharacterized protein
STRINGLOC_Os07g12130.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-45myb domain protein 98